PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01001056G0170
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family bZIP
Protein Properties Length: 165aa    MW: 18212.4 Da    PI: 9.8983
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01001056G0170genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.61.7e-10765563
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                     kr +r   NR +A rs +RK  +i+eLe+kv+ L++e ++L  +l  l+  +a l +++
  PH01001056G0170  7 KRVKRVLANRQSAARSKERKMRYIAELEQKVQILQTEATRLSTQLALLQRDSAGLATQN 65
                     999*********************************************99998887766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003389.6E-17367IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.875568IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.6E-11764No hitNo description
PfamPF001701.4E-9765IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.89E-11758No hitNo description
CDDcd147034.59E-18859No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 165 aa     Download sequence    Send to blast
MVLADPKRVK RVLANRQSAA RSKERKMRYI AELEQKVQIL QTEATRLSTQ LALLQRDSAG  60
LATQNNELKF RLQAMEQQAQ LRDALNEALT TEVQHLKIAT AELGNSCSSN GLSSADPTQR  120
SESDASIAAA GYNDTVLSTA TDSRTAQRRT MNQKNDYRDI WTGS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004985885.12e-62PREDICTED: transcription factor RF2b-like
RefseqXP_006649313.15e-65PREDICTED: transcription factor RF2a-like
SwissprotQ69IL44e-45RF2A_ORYSJ; Transcription factor RF2a
TrEMBLJ3LJI75e-65J3LJI7_ORYBR; Uncharacterized protein
STRINGOB03G12130.11e-64(Oryza brachyantha)
STRINGSi035841m5e-62(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21230.16e-46bZIP family protein